"clip" 검색결과 201-220 / 7,889건

• 

  중1 2학기 공개수업 영문지도안(에듀테크포함)

  paragraph again.- Have students learn the new words and expressions.- Have students watch the video clip ... Students will understand ‘Chullo’ and how they show culture in Peru.? ... and learn about‘the weaving history in Peru’.- Have students present their writings to the class.Textbook

  리포트 | 1페이지 | 2,500원 | 등록일 2023.09.12

  다운로드 장바구니
• 

  캡스톤디자인2 레포트

  However, if you dry it, it is difficult to pass and slip accidents can occur in the case of communal ... : A Motor● The direction of the windThe wind was constructed to come in from below and go up.It will ... cool the motor a little bit as it goes up and down the wind.Select mesh structure above and below to

  시험자료 | 6페이지 | 1,500원 | 등록일 2022.07.31

  다운로드 장바구니
• 

  호흡곤란시 간호

  교감신경 흥분약- 약리 작용 : Adenylyl cyclase를 활성화하여 cAMP를 증가시킴으로써 protein kinase(PKA)가 활성화되어 기관지를 확장시킨다.- 임상용도 ... Methyxanthine 유도체- 약리 작용 : cAMP를 분해시키는 phosphodiesterase를 억제하여 세포 내 cAMP의 농도를 증가시키고, adenosine의 작용을 억제하여 ... 흡기 시 손의 움 직임을 관찰한다.⑤ 입술을 오므리고 호기한다(pursed-lip 호흡).

  리포트 | 5페이지 | 1,000원 | 등록일 2019.09.30

  다운로드 장바구니
• 

  [지도안] 영어교사 채용 수업시연 지도안입니다. 실제로 수업시연에서 최종 합격한 작품입니다. 수업시연 지도안을 어떻게 작성할지 막막하신 분들은 반드시 읽어보시기 바랍니다.

  a video clip? pair work? work sheet#1(=Crossword Puzzle)? pair work? ... today’s vocabularies- to watch a video clip related to today’s text- to brainstorm what the today’s ... pptPre-reading◎Motivational Activity- to show Ss a video clip related to today’s text- to have Ss brainstorm

  리포트 | 2페이지 | 1,000원 | 등록일 2020.04.30

  다운로드 장바구니
• 

  A+ 받은 ORIF, aneurysm 수술실 케이스

  동맥류를 찾아 조심스럽게 주위 조직과 분리하여 동맥류의 경부를 clipping 함6. ... , LT 400 EthiconAneurysm clip, Microscope DrapesTCD(transcranial Doppler), Elastic Bandage, 전기혈패드, Medifoam ... 중앙라인으로 양쪽 측두엽의 귀 옆과 귀 뒤까지 삭모하여 povidone으로 소독함.- 피부소독제 : povidone6) 수술에 사용된 기계 및 기구sofsilk, vicryl, Liga clip

  리포트 | 5페이지 | 1,500원 | 등록일 2020.07.06

  다운로드 장바구니
• 

  수술실 컨퍼런스 보고서, Vascular bypass operation, 혈관우회로술, 수술기구 및 장비, 수술 과정, 수술 후 검체관리, 수술 후 환자 안전관리

  clip holder&clip L/M/S, EB 6inch약물 : papaverin, internal saline 1L 3ea소모품Surgical 35cm, P.R.N 타코콤, Tisseel ... 박리시 Side vessel들은 Hemo clip 또는 Silk로 Ligation한다. ... 박리시 Side vessel들은 Hemo clip 또는 Silk로 Ligation한다.

  리포트 | 7페이지 | 2,000원 | 등록일 2021.07.21

  다운로드 장바구니
• 

  충수절제술 case study (A+)

  Dissector로 충수돌기 상단부의 장간막을 박리한 후endo clip으로 장간막을 절제한다.3. ... 충수돌기상단부에 결찰된 endo loop 2개를 남기고 endo scissor로절제한다. (외과의에 따라 Hemolok clip을 사용하기도 함).4. ... Tower clip: 수술 부위 주변을 덮는 천을 잡아 고정시킴2. Mosquito(c): 봉합사를 고정시켜 놓거나 조직을 벌릴 때3. Hemostate: 지혈할 때 사용4.

  리포트 | 7페이지 | 2,000원 | 등록일 2022.01.25 | 수정일 2022.03.29

  다운로드 장바구니
• 

  한국외대 영문과 - 영어소설 창작에세이

  He became very thin and his lips were chapped.

  리포트 | 2페이지 | 2,000원 | 등록일 2021.05.01

  다운로드 장바구니
• 

  A+받은 아동간호 세기관지염[Bronchiolitis] CASE STUDY입니다 진단2개 과정2개입니다

  HEENT : clear sclera, pinkish conjuctiva, dry lip mucosa(-)? ... 식이 : 분유 150~200cc q2hr + 고형식이? ... 분만형태 : C/S? 출생 시 체중 : 2.96kg [산부인과]? 현재 : 신장 176.4cm 체중 10.9kg? 입원경로 : 응급?

  리포트 | 5페이지 | 2,000원 | 등록일 2022.12.16

  다운로드 장바구니
• 

  모성간호학실습 _ 자연분만 의료물품강의 요약 보고서

  scissor 1개­ 꿰맨 실(봉합 후)을 자를 때 사용③ Smooth pin 1개④ Tooth pin 1개⑤ Towel clip 2개­ 방포가 밀리지 않도록 하기 위해서 사용⑥ Hemostat ... care용 scissor 1개⑦ 신생아 cord care용 알콜볼과 clamp과 담긴 종지⑧ 수술부위 소독 후 닦을 중방 2개⑨ 수술부위 소독용(2차) 베타딘 종지 2개⑩ 베타딘 ... 분만상 상차림① Gown과 8번 glove (인턴이 사용)② C/S drape, glove 6개③ 대야 속의 물품들 (medifoam, needle, counter, mess, suction

  리포트 | 3페이지 | 1,000원 | 등록일 2024.08.03

  다운로드 장바구니
• 

  인간의 본성(성선설)

  /mobile/clip/detl/selectClipDetail? ... *EBS 다큐멘터리 아이의 사생활 제 2부 도덕성 Hyperlink "http://m.clipbank.ebs.co.kr/mobile/clip/detl/selectClipDetail? ... subType=50002491&subMenu=50002492&subList=50002949&typeId=1&clipId=VOD_20111230_00313" http://m.clipbank.ebs.co.kr

  리포트 | 2페이지 | 1,000원 | 등록일 2019.12.16 | 수정일 2021.09.25

  다운로드 장바구니
• 

  A+ 성인간호학_수술실 - 개복술 case study [right posterior sectionectomy of liver (open)]

  남은 절개 부분 Argon 이용하여 지혈하고 surgipro 6-0 이용하여 suture 반복함. clip small 이용하여 봉합하고 간 조직 절개면에 collastat 과 surgiguard ... Draping수술 부위인 우상복부 중심으로 네 면에 멸균포를 덮고 towel clip 으로 각 면 포를 고정함. 테이프가 부착된 일회용 멸균 방포로 네면을 한번에 덮음. ... 소독간호사와 순환간호사가 구두로 counting 추가 실시함.2.

  리포트 | 2페이지 | 2,000원 | 등록일 2020.03.14

  다운로드 장바구니
• 

  신생아실 의학용어 (현직간호사 작성)

  fracturecleft lip & cleft palatecryptorchismcontinuous positive airway pressure (CPAP)diaper rashcleft ... lip & palatedislocation of the hipdwarfismdysphagiaepilepsyerythroblastosis fetalisesophageal atresiafacial ... CHF : congestive heart failure? C/S : cesarean section? CPAP : continuous positive air pressure?

  리포트 | 3페이지 | 4,000원 | 등록일 2020.04.20

  다운로드 장바구니
• 

  [성인간호학]기말고사

  작업장에서 지속적인 먼지, 연기 및 가 스 노출을 피함② COPD에 대한 정보③ 흡입치료제 사용법 및 다른 치료에 대한 설명④ 호흡곤란 감소를 위한 방법 : 입술오므리기(pursed-lip ... 중심정맥관(peripherally inserted central catheters, PICC), 터널형 카테터(tunneled catheter)로 히크만 카테터(Hickman catheter ... ), 브록비악 카테 터(Broviac catheter), 그로숑 카테터(Groshong catheter)등이 있다, 또한 매립형 포트 (implanted port)로는 케모포트(chemoport

  방송통신대 | 5페이지 | 3,000원 | 등록일 2023.11.01

  다운로드 장바구니
• 

  충북대학교 전자공학부 전자회로실험I 결과보고서 실험 12. MOSFET 차동증폭기

  차동 출력임을 확인하였고 전압크기가 커지면 clipping이 일어나는 것을 확인하였습니다. 공통모드 거절일 경우 신호가 직선으로 나왔습니다. ... _{01} -V _{02}=2.88V 이므로A _{d} =28.8(3) 차동 대신호의 출력신호 한계100mV에서 조금씩 전압을 증가 => 400mV 정도 되었을 때 삼각파 파형 clipping변위폭 ... : 6V(4) 공통모드 거절V _{01}=V _{02}=80mV,A _{cm}=0.08 나왔고,V _{01} -V _{02}=160mV2.

  리포트 | 2페이지 | 2,000원 | 등록일 2020.09.24

  다운로드 장바구니
• 

  Gamma nail procedure

  insertion⑧ 똑딱이로 u-blade clip 똑딱 밀어줌 -> T-handle 다시 연결한 후 빼내고 sleeve제거 후 u-blade cap screw insertion⑨ ... 육각 driver로 U-blade driver 풀어서 빼낸 후 T-handle + driver(얇고 긴 thread 있는 rod) insertion해서 T-handle만 빼낸 후 clip ... drill chuck, short chuck(2), mallet (大), monkey, 쇠자-소모품: 가운(2), 소포(2), 반포(2), light handle, bovie, suction

  리포트 | 2페이지 | 2,500원 | 등록일 2020.07.19

  다운로드 장바구니
• 

  금도끼 은도끼 영어 동화 스토리텔링 지도안

  나무꾼1 : My axe slipped out of my hands and fell into the pond.산신령님 : Hmm... ... 나무꾼1 : My axe slipped out of my hands and fell into the pond.산신령님 : Hmm... ... Assign a scene to catch group.T. Decide your roles for each scene.T.

  리포트 | 5페이지 | 1,000원 | 등록일 2023.03.19

  다운로드 장바구니
• 

  The Necklace

  The girl was one of those pretty and charming young creatures who sometimes are born, as if by a slip ... of fate, into a family of clerks. ... of the Ministry of Public Instruction.She dressed plainly because she could not dress well, but she

  리포트 | 11페이지 | 4,500원 | 등록일 2022.04.17

  다운로드 장바구니
• 

  미국문학의이해 - 기말(온라인) 20년1학기

  .※ 다음을 읽고 물음에 답하시오. (35∼36)I take this ⓐ evanescence and lubricity of all objects, which lets them slip ... The sun was coming up over the hills. A bass jumped, making a circle in the water. ... My tenderness of heart was even so conspicuous as to make me the jest of my companions.

  방송통신대 | 12페이지 | 4,000원 | 등록일 2021.01.24

  다운로드 장바구니
• 

  수술절차 관찰 기록지 (SLNB-sentinel lymph node biopsy/T.T-Total Thyroidectomy)

  -mess-Bovie-Surgi-clip (small)-kelly-spoid-retractor-forcep-scissor-ligasure-vicryl[23-2 성인간호학실습4] (

  리포트 | 4페이지 | 2,000원 | 등록일 2023.09.20 | 수정일 2023.09.22

  다운로드 장바구니